This is the last task of the August Developer Challenge on ABAP Core Data Services. The responses we have seen so far is excellent and appreciate each one of you in taking time to complete the challenge. We have seen some good conversations about the...
First of all, thanks for the overwhelming response to the ABAP Developer Challenge. Kudos to everyone who took time out of their busy schedule and finished the pre-requisite – Task 0 last week.Now let us dive right into the challenge.Task 1 - In this...
Can some one tell me abt logical unit of work(LUW).
Hi,when i read a file use GUI_UPLOAD line by line, i can't get a whole line maybe for the restrained line size in the function. can i set the max line size by myself ? so i can read a whole line.if not, i just image maybe i can set the read mode to a...
hi friends !I'm using the direct input program RMDATIND for uploading the material master data. and i'm facing the error:"Too many logical errors (in terms of business processes); maximum was 100"thanks and regards,sachin soni
hi experts, cud u plz tell me in which tables or fields the item category and delivered date of the PR is stored...plz help me.thnx in advance.
Hi, if tr r 100 records to be updated, if 3, 52 and 99 records are failed ,what happens in case of session and calltransaction method, how we can correct the errors in both cases and what happens they will update remaining fields or not.
hi experts,Difference between SY-TABIX and SY-INDEX? Where it is used? Can u check SY-SUBRC after perform?thanx,loki
hi experts, Can you have two detail lists from the basic list at the same time? If yes how and if no why?thanx,loki.
Hi, any body can give me the scenerio when we go for dialog programming. If possible tell me the reqirment.
Hello every oneI have implemented the customer master enhancement using the baddis : 'CUSTOMER_ADD_DATA_CS' and 'CUSTOMER_ADD_DATA' , scenario is that, I have added a new tab, to customer master screen and the new screen under that tab has 4 fields, ...
hi gurus,what is the use of select for all entries in an internal table? and when you are using 2 internal table in program, you have decided to use for all entries statement to retrieve data but unfortunately ther...
Hi All,I am getting a message from external system and it has date and time as part of message. so before updating the database i want to perform format check for date and time. ( not value check: i know for value check "date_check_palusibilty" is u...
Hi All,I Have following 5 tables in my Database.LTAP-TABNAMEFIELDNAMEKEYFLAG-LTAPMANDTXLTAPLGNUMXLTAPTANUMXLTAPTAPOSXLTAPVLPLA-Z0MNH-TABNAMEFIELDNAMEKEYFLAG-Z0MNHMANDTXZ0MNHWERKSXZ0MNHZMANNOXZ0MNHLGNUMXZ0MNHAENAMZ0MNHBUDATZ0MNHCPUTMZ0MNHLAEDAZ0MNHSTA...
hi gurus, You are running a report. It is taking long time for execution. What steps will you do to reduce the execution time.thanx,loki
hi guru.please <b>tell me ow to data upload when data is in exel format</b>.regards.subhasis.
Hi using CONCATENATE i want to align the data in the center how do this,help me.regards,sivakumar
Hi!I need smart form specification on SD or FI module.can anyone please send me some helpful links on that?Kind RegardsTroy.
hi guru's, After running a BDC program in background, next day morning when you see the results, few records are not updated(error records). What will you do then?thanxloki
Hi,I have a final internal table with few fields from MSEG , MKPF table and a field named CREATEDBY from GOHEAD structure . my doubt is how to populate this structure field into the internal table.ThanksKrishna
For the below alv report after sel screen it is displaying callback event user_command does not exist what is wrong with the below please suggest me.REPORT ZALV.TABLES:LFA1,EKKO,EKPO.select-options:s_lifnr for lfa1-lifnr.DATA:Begin of itab occurs 0,...
Hi, I never get a chance to work in HR module. I want to know being an ABAP programmer what should we have to know in HR Module. I also want to know what are infotypes. what's the difference between infotypes and internal tables?
I need some advice on the ALV. Here is my problem. I am using the following function in my program. CALL FUNCTION 'REUSE_ALV_FIELDCATALOG_MERGE'CALL FUNCTION 'REUSE_ALV_GRID_DISPLAY' This is my internal table.VKBUR LIKE VBAK-VKBUR, "Sales officeVBEL...
If i only know the description of a field..how can i identify the field name and the corresponding table or structure..
hello iam in to my first project and iam transfering legacy data which contains item id and quantity and this record is having matnr aswell in database so when iupload flatfile with item id and quantity in my sapscreen matnr and quantity should be...
Hello there,I hope to get some help here. I am unable to get the exti EXIT_SAPLMV02_002 working in my inbound.I believe that this exit is called in IDOC_INPUT_MATMAS01. I have put do loop break point in the exit to see whether this user exit is activ...
hi,i have 2 internal table and want to do add-corresponding.the problem is i have character type field, example ekgrp (purchasing group) where the value is i38.when run i got runtime error says unable to interpret 'i38' as a number. how should i avoi...
Hello experts,I am currently working on an object where in i need to upload time events data through PA61 transaction uusing BDC.With the code i have written i m able to upload only the first three time evetns of a particular personnel no.Can anybody...
REPORT YZWX00301_06 LINE-SIZE 142 LINE-COUNT 65 MESSAGE-ID YM1 NO STANDARD PAGE HEADING .*----INCLUDE*----INCLUDE: YXXI00050.*----*TABLES use table define*----TABLES: MARA, " Materi...
Hi,I created filename z001 in sap and its already running, but when I log to AL11 dir temp, I can’t see z001. I already used open dataset but its not working. Can you please give me detailed sample program? Thanks.
Hi All, Can you please tell me the function module name, which checks the destination server is up or not???Regards, Srikanth.
Hi group Quick question...while doing a PO change ( IDOC_INPUT_ORDCHG)....sales order line items are to be deleted....I know that this needs to be done in a user exit...i am trying to nail down to the right user exit...... I found only one user...
Made the changes in the include and the copied standard layout program in the script assignment but How do I know the standard program I need to run to check the output. The main se38 program is SAPLZ_64_V55E but how can I execute it my program. Plea...
Dear Experts,Currently a report is being displayed using CL_GUI_ALV_TREE class.one of the column is check box and it is editable in the output list.The checkbox column is getting displayed and is editable in all the leafs but I can't see the checkbox...
Hi All,I designed the screen like belowI am using doc container with split one is for small ALV grid and next is for text editor. - Upper Portion of screen (Upper portion is splited vertically for alv grid and text editor)in the bottom of screen i ha...
Hi all,i need to add some new fields in VA01 transaction in header & item level so that when i will go for save the sales order those datas will store in VBAK & VBAP table.1)To add some fields in VA01--what should i prefer --menu exit or screen exit ...
Hi,I am testing a BAPI in se37 and its working good. I see that another bapi 'BAPI_TRANSACTION_COMMIT' has to be called in sequence to commit to database. How do I Call this in sequence in se37 along with the first function module?Thanks.
Hi,I have two table controls and a "Transfer" button on a dialog screen. The 1st one contains the data extracted from a table (hundred of entries) and has the scroll up/down functionality. If I select multiple rows from the 1st table control and hit ...
Hi,I need to check the size of the spool in my system. How can I check that?Let me know please.Much Thanks!
Hello SAP Gurus, Can anyone let me know the table which shows whether the worfkflow is approved or rejected in a SALES ORDER.It would be great if you can share some of our thoughts.thanks,Krishna
Hello guys !!We have some reportes created con transaction ke30, but now we have to use different tcode for each report. How can I assign a tcode for each report that shows ke30.Thanks !Javier
Hi all, I want to know if there is a report to change the status of Purchase order.regardssaurabh
Hi all,Do I need to Change the status to 64 before reprocessing an IDoc? What are the tcodes allowed for reprocessing and the tcodes for archiving.. If you could give these two lists it would be great.Thanks,Charles.
as I can call a ALV within a table control from an icon, depending if it has or non information, such icon activates?
Hi all,I will get output file with 1.6 million records but 6000 materials.I need to process 500 materials . How can i do that ? I need to process by materials. Here my input file.a1,1111,123,a1,1112,134a1,1123,123,a1,1134,134a2,1111,123,a2,1112,134a2...
We have a requirement to add custom fields to MARC which was done easily. Now we'd like to be able to update these fields via MM17 (MASS) but the fields don't appear. What do we need to do to allow custom fields to be updated via MASS?Thanks,-=Rob=...
Hi Experts,My requirement is like blow,''Payment terms of the invoice for column J should be read from VF03 of the billing document (Table VBRK). If not available in VBRK, obtain the same from BSAD (field ZTERM) but with the earliest date in the chan...
I am working on my first screen painter application and have the following problem:I created a dropdown list that gets populated from an internal table. How can I now read out the value (the text, not the key) of the selected entry?One part that I am...
Hi all,is it possible to maintain different page formats and different font family?Thanks in advanceRambabu.A
Hi all, We have a report prgm that will send a mail to SCOT to lotus notes. In lotus notes, we have a group mail (Example: SAP_TEAM). How we can send mails to the lotus notes group...? Thanks,J Kumar.
Hi all ,This is my code .some how my read statement is not workng . Can any one tell me what will be the issue with read statement?FORM delete_entries. DATA:v_indx LIKE sy-tabix.*Get delete materials from zwplccrimsr table SORT t_split BY matnr zwa...
I need for hundreds of HR roles that have P_ORGIN auth. object to copy the P_ORGIN object to P_ORGINCON object.As PFCG is an enjoy SAP tx, I cannot do BDC and I am wondering if there is a BAPI to do this process.Thanks.
| User | Count |
|---|---|
| 6 | |
| 4 | |
| 3 | |
| 2 | |
| 2 | |
| 2 | |
| 2 | |
| 2 | |
| 1 | |
| 1 |
